Divers

vodafone kündigung erfahrungen

] LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, { { ] LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] ] "action" : "rerender" { watching = true; "event" : "addThreadUserEmailSubscription", } "actions" : [ { "kudosable" : "true", } { "message" : "88659", }, if ( count == neededkeys.length ) { "action" : "rerender" ] { ] "useSubjectIcons" : "true", "event" : "MessagesWidgetEditCommentForm", $(document).ready(function(){ "actions" : [ } // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName,message", "context" : "", "actions" : [ "context" : "", LITHIUM.Dialog.options['-2135019179'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "componentId" : "forums.widget.message-view", "action" : "rerender" "action" : "rerender" "event" : "addThreadUserEmailSubscription", "event" : "MessagesWidgetMessageEdit", ] }, "action" : "rerender" } ] { o.innerHTML = ""; ] "}); } }); }); { { ] { "action" : "rerender" $('.lia-autocomplete-footer').append(ctaHTML); "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addThreadUserEmailSubscription", "messageViewOptions" : "1111110111111111111110111110100101001101" "componentId" : "forums.widget.message-view", } return; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88664,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "pulsate" }, }, }, }); }, "actions" : [ ], "actions" : [ } } "context" : "envParam:selectedMessage", }, "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { watching = false; { "disableLabelLinks" : "false", } }, "useSimpleView" : "false", "event" : "removeThreadUserEmailSubscription", { "context" : "", { })(LITHIUM.jQuery); "context" : "envParam:quiltName", "useSimpleView" : "false", $(this).next().toggle(); clearWarning(pagerId); LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" "message" : "88661", { "disableLabelLinks" : "false", ] { }); { { }, "message" : "88659", { "buttonDialogCloseAlt" : "Schließen", "event" : "addThreadUserEmailSubscription", element.siblings('li').find('ul').slideUp(); return; "eventActions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "displaySubject" : "true", LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { "action" : "pulsate" }, "event" : "removeMessageUserEmailSubscription", Leistungen. "displaySubject" : "true", }, "context" : "envParam:quiltName,message", "action" : "rerender" ] ', 'ajax'); $(document).ready(function(){ "actions" : [ "action" : "addClassName" "context" : "envParam:entity", } "useSimpleView" : "false", }, { { }); } "actions" : [ "event" : "removeMessageUserEmailSubscription", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetMessageEdit", { }, if ( Number(val) > 4 ) "kudosable" : "true", }, "initiatorDataMatcher" : "data-lia-message-uid" } { }, "action" : "rerender" } ] "action" : "rerender" }, } "context" : "envParam:quiltName,message", { .attr('aria-selected','false'); "selector" : "#messageview_1", "context" : "", "triggerEvent" : "click", ] { "action" : "rerender" { "actions" : [ "event" : "MessagesWidgetEditAnswerForm", watching = true; "selector" : "#kudosButtonV2_4", } LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetEditAnswerForm", { } LITHIUM.AjaxSupport.ComponentEvents.set({ "kudosable" : "true", "event" : "MessagesWidgetMessageEdit", ', 'ajax'); "event" : "AcceptSolutionAction", { "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "ProductAnswerComment", ] ] "context" : "", { ', 'ajax'); "actions" : [ "event" : "MessagesWidgetEditAnswerForm", } ] }, }, "actions" : [ "defaultAriaLabel" : "", "action" : "rerender" { { "actions" : [ } }); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/21837","ajaxErrorEventName":"LITHIUM:ajaxError","token":"fLPVSa8y3Qbqcd_ErWF49pDbEnEtDhvrqynK2BjTCOg. "initiatorDataMatcher" : "data-lia-message-uid" var ctaHTML = '. "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", "useCountToKudo" : "false", }); }, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); } { "event" : "MessagesWidgetEditCommentForm", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88655,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ { "action" : "rerender" "useCountToKudo" : "false", "action" : "rerender" "action" : "rerender" "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88661,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "; LITHIUM.Loader.runJsAttached(); "event" : "ProductAnswer", "event" : "ProductAnswerComment", { "revokeMode" : "true", "action" : "rerender" { "action" : "pulsate" "event" : "removeThreadUserEmailSubscription", "context" : "envParam:feedbackData", { }, }, "event" : "MessagesWidgetEditCommentForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", }, "context" : "", "actions" : [ clearWarning(pagerId); { ] "actions" : [ { "action" : "rerender" "actions" : [ "context" : "", function clearWarning(pagerId) { ] }); "entity" : "88663", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" { "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { ] Vodafone Kündigung: Wie klappt das Kündigen beim zweitgrößten deutschen Mobilfunkanbieter Vodafone? ] }, "action" : "rerender" { } "action" : "addClassName" { { } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-88664 .lia-rating-control-passive', '#form_8'); "actions" : [ "context" : "", "eventActions" : [ "event" : "ProductMessageEdit", ] "defaultAriaLabel" : "", { } }, } { }, LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":677,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewlbWw4EQgpebxt5QHVVHHAhDFMNUkZaVUhgCV1TBA1ZARhSWF4ARUtDRw9PXAtBSVFcORkSXR8SPhhcDQUBB0caRF9AAw9SLVERDgNXBFEOAlJaDlYCBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVVAcMB1xVURQCUlEOSQEFBQdIVwBfAU9TVVVQV1dXBgNfClRAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "action" : "rerender" }, "actions" : [ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234335}); "action" : "rerender" count = 0; { o.innerHTML = "Page must be an integer number. LITHIUM.Auth.CHECK_SESSION_TOKEN = 'noDmUZa-wcRP6S_h6Z1usvhMqSYBIvBnmgSZsEvGjrU. ] } "kudosable" : "true", "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ Bist du sicher, dass du fortfahren möchtest? } }, { { ] } "context" : "envParam:selectedMessage", "actions" : [ "event" : "addMessageUserEmailSubscription", { "event" : "MessagesWidgetAnswerForm", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-88663 .lia-rating-control-passive', '#form_7'); "actions" : [ "parameters" : { { "message" : "88660", { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "actions" : [ "actions" : [ { LITHIUM.Dialog.options['-1694381393'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "truncateBody" : "true", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "accessibility" : false, { } Nachdem Sie Ihren Vodafone Vertrag gekündigt haben, bekommen Sie 7 Tage vor Vertragsende und am letzten Vertragstag eine SMS mit Informationen. "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", }, "context" : "", "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "; }); "context" : "envParam:entity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "}); "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "actions" : [ "actions" : [ { "event" : "approveMessage", function disableInput(pagerId) { "event" : "MessagesWidgetCommentForm", "actions" : [ }, // We're good so far. ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetCommentForm", "selector" : "#messageview_0", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_Mobilfunk/thread-id/21837","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mXFx58CeMDw1Mr6yFiLhcphHQSzjnDYkBXOVNNIEMbY. { { "context" : "", }, { "actions" : [ } } } } "useSubjectIcons" : "true", "action" : "rerender" { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { $(this).toggleClass('active'); ] "event" : "kudoEntity", "initiatorDataMatcher" : "data-lia-message-uid" }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88663,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } ] "useSimpleView" : "false", "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "event" : "RevokeSolutionAction", "actions" : [ }, "useSimpleView" : "false", setWarning(pagerId); } }, { "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", }, "actions" : [ "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,expandedQuiltName", }, { }, { "event" : "MessagesWidgetEditCommentForm", }, "event" : "ProductAnswer", "event" : "ProductAnswer", "actions" : [ }, { ] if ( neededkeys[count] == key ) { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/21837","ajaxErrorEventName":"LITHIUM:ajaxError","token":"juDHzz3kYSQrOdszbf3wu8DguWACrARZlvrqXeucgVs. } "message" : "88664", "action" : "rerender" }, return true; "defaultAriaLabel" : "", { } LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":88664,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ Daniel zu freenet FLEX: Tests, Erfahrungen & Bewertungen zum App-basierten Mobilfunktarif im Vodafone-Netz Christian (Redaktion) zu ALDI TALK Mega-Bundle vom 19.11.2020 bis max. ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "kudosable" : "true", "actions" : [ count = 0; "context" : "envParam:quiltName,message,product,contextId,contextUrl", $(document).ready(function(){ LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. aboalarm empfiehlt außerdem, Abmachungen nicht telefonisch zu treffen, sondern sich alles schriftlich geben zu lassen (per Brief, E-Mail oder Fax). ] })(LITHIUM.jQuery); "actions" : [ "}); } "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "actions" : [ ;(function($) { { { { "kudosLinksDisabled" : "false", Online-Kündigungsdienste haben bereits alle notwendigen Informationen und Adressen für die Kündigung gesammelt. "action" : "rerender" { }); "context" : "envParam:entity", }, { "actions" : [ "defaultAriaLabel" : "", "actions" : [ } "action" : "rerender" "useCountToKudo" : "false", "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); function doChecks(pagerId, val) { "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/21837","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TY9TnuQkFDnDtAR3uvZTVcIXbTRxeukeXDRoYsyYos8. } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "addMessageUserEmailSubscription", } "action" : "addClassName" Wir berichten lediglich von den Erfahrungen, die unsere Kunden und unser Kundenservice mit dem Anbieter gemacht haben. { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); { "action" : "rerender" { "context" : "", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "dialogContentCssClass" : "lia-panel-dialog-content", ] { "event" : "approveMessage", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ', 'ajax'); ] LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "actions" : [ "action" : "rerender"

Mietangebot Jobcenter Gelsenkirchen, Medizinische Fußpflege Köln Südstadt, Gerlos Stausee Restaurant, Verlassene Kaserne österreich, Felgenkonfigurator Point S, Prospektständer Für Außenbereich, Hochzeitslocation Kreis Aschaffenburg, Il Mulino Warendorf Karte, Welcher Fos Zweig Passt Zu Mir Test,