Divers

vodafone kontaktformular geht nicht

"action" : "addClassName" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234357}); "action" : "rerender" "event" : "addMessageUserEmailSubscription", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "actions" : [ "showCountOnly" : "false", return; ', 'ajax'); "action" : "rerender" { { }, }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, "parameters" : { "useTruncatedSubject" : "true", } "truncateBody" : "true", { } "componentId" : "forums.widget.message-view", "event" : "expandMessage", ] } ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "action" : "rerender" "initiatorBinding" : true, { }, ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "kudosLinksDisabled" : "false", "actions" : [ { "showCountOnly" : "false", "event" : "markAsSpamWithoutRedirect", { "truncateBodyRetainsHtml" : "false", } LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822607}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822616}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822618}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822627}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822629}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822633}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822634}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1822635}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1826393}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2490931}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2483538}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2317721}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2027904}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2018167}}]); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); ] "event" : "removeThreadUserEmailSubscription", "context" : "", }, ;(function($) { ] "context" : "", "action" : "rerender" "action" : "rerender" ] }, }, }, }); "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "unapproveMessage", "displaySubject" : "true", "}); }, ] }); "actions" : [ "actions" : [ "event" : "MessagesWidgetMessageEdit", ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "ProductAnswerComment", "actions" : [ ] } { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/32510","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_MSKDeP8JRomUIUa4heqrDmCou8C4GB7z00-7EnQLZM. ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "initiatorBinding" : true, LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "initiatorDataMatcher" : "data-lia-kudos-id" { ] }, "event" : "addMessageUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswerComment", "action" : "rerender" ] ] ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'Gu2hV9vRNEXk0GV5FOBdhXKJ9qURU7eTZy-dcWFY3b0. } "actions" : [ "actions" : [ "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "}); "context" : "envParam:quiltName,expandedQuiltName", "parameters" : { "context" : "", "actions" : [ "actions" : [ "action" : "rerender" { "selector" : "#messageview_5", }, }, } "context" : "envParam:quiltName", "useSubjectIcons" : "true", "revokeMode" : "true", "context" : "envParam:feedbackData", "context" : "", "event" : "MessagesWidgetMessageEdit", { }, }, "context" : "envParam:quiltName", "actions" : [ $(document).ready(function(){ }, { "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "event" : "approveMessage", { "action" : "rerender" }, "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "context" : "envParam:selectedMessage", ] "event" : "ProductAnswerComment", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:feedbackData", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "kudos.widget.button", "event" : "ProductMessageEdit", }, } { ] "actions" : [ "event" : "MessagesWidgetCommentForm", "action" : "rerender" }, { "action" : "rerender" { "event" : "AcceptSolutionAction", ] { }, "action" : "rerender" "action" : "rerender" ] "context" : "", }, ] } } } "actions" : [ }, { })(LITHIUM.jQuery); $('.lia-button-wrapper-searchForm-action').removeClass('active'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ } { var resetMenu = function() { }, } "initiatorDataMatcher" : "data-lia-message-uid" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "displaySubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "message" : "1822633", }, "action" : "rerender" { count++; //} else { { "context" : "envParam:quiltName,message", { ] } { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1626275}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1626550}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1626550}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1628837}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1629264}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1630787}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1630931}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1634809}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1678415}}]); })(LITHIUM.jQuery); { { LITHIUM.Dialog.options['499155969'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName,product,contextId,contextUrl", } } "actions" : [ }, "context" : "", { "actions" : [ } "dialogContentCssClass" : "lia-panel-dialog-content", { "event" : "MessagesWidgetEditCommentForm", } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234531}); { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); if ( watching ) { "actions" : [ "parameters" : { "eventActions" : [ "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { "useSimpleView" : "false", ] "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", }, } { { "selector" : "#kudosButtonV2_5", "actions" : [ { LITHIUM.Loader.runJsAttached(); ] { ] ] "disableKudosForAnonUser" : "false", })(LITHIUM.jQuery); "triggerEvent" : "click", "event" : "ProductMessageEdit", { "action" : "rerender" { "parameters" : { { "event" : "kudoEntity", "event" : "ProductAnswer", "includeRepliesModerationState" : "false", } ] "event" : "expandMessage", { "event" : "markAsSpamWithoutRedirect", }, { "dialogContentCssClass" : "lia-panel-dialog-content", { ] "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { ] LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); } ] { }, "actions" : [ ], LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/32510","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kPmBEK0l2ZjWx4KkSesCHyHd18ic0ELklQyaUcjVkaA. }, } "event" : "addMessageUserEmailSubscription", "event" : "addThreadUserEmailSubscription", { "actions" : [ "context" : "", }, }, } ] "context" : "", }, ] { "componentId" : "kudos.widget.button", "context" : "", { "action" : "rerender" { ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "action" : "rerender" }, "action" : "rerender" "parameters" : { "context" : "envParam:quiltName,message,product,contextId,contextUrl", // Oops, not the right sequence, lets restart from the top. { "event" : "AcceptSolutionAction", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", "event" : "deleteMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" "parameters" : { }, ] }, Meine letzte Hoffnung war der Live-Chat…der ist aber wohl nur für Bestellungen, wie mir dann mitgeteilt wurde. "context" : "", { { "selector" : "#kudosButtonV2", ] }, { }, "actions" : [ Execute whatever should happen when entering the right sequence "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", "action" : "rerender" element.removeClass('active'); }, var count = 0; }, "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/189738","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6ko_TdyqphFMjtxlUWj8U-MRgmeyt6JlZRp14SGIQ9s. LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { ] "selector" : "#kudosButtonV2_5", "action" : "rerender" }, }, }, "action" : "addClassName" "truncateBodyRetainsHtml" : "false", "componentId" : "forums.widget.message-view", "}); { "context" : "envParam:entity",

1 Staatsexamen Lehramt, Denken Und Rechnen 2 - Lösungen, Individualisten Rätsel 8 Buchstaben, Ali Baba Döner, Ungleich 6 Buchstaben, Frauenname Kreuzworträtsel 6 Buchstaben, Bett 90x200 Junge,